Thanks, very informative. Perhaps it would be best to remove these sequences, rather than guess (I'm not sure which I would choose)? They form part of a large evidence set so are not necessarily required.
Hi,
I am receiving the following error when running exonerate-2.2.0:
** FATAL ERROR **: Unrecognised symbol 'J' (ascii:74)
Here are a couple of examples of where this occurs:
** FATAL ERROR **: Unrecognised symbol 'J' (ascii:74) file:[../../blastdb/evidence_aln_seqs/output2/evidence.seqmasked.cat.1-nopipe.split.4.fa] seq:[gi614497259gbAHX42233.1] pos:[267]
>gi614497259gbAHX42233.1
FNIFIRGLFENMKVEEAISVWQVLQEDGCVADSTTYGVLIHGFCKNGYLNKALWVLTDAE
DKGNDLDVFAYSSIINGLCNARRVDEGFDTLDRMTKHGCKPNAHVCNTLLNGLIRASKID
DAIRFFSEMAAKDCLXTVVTYNTLIDGLCKVERFDEAYLLVKEMLEKGWKPDIITYSLLM
RGLCQDKKIDMALNLWCQVVEKGLKPDVIMHNIIIHGLCSAGKVGDALQLYLRMSQCDCV
PNLVTLNTLMEGFYRARDCLNASVIWARJLRSGLKPDJISYNIVLKGLCSCIDY
** FATAL ERROR **: Unrecognised symbol 'J' (ascii:74) file:[../../blastdb/evidence_aln_seqs/output2/evidence.seqmasked.cat.1-nopipe.split.3.fa] seq:[gi614497313gbAHX42260.1] pos:[302]
>gi614497313gbAHX42260.1
IKGGFEIWELMGRDGVRNIFSFNILIRGLFESRKVEEAISVWQVLQENGCAADSTTYGVL
IHGFCKNGYLNKALLVLTEAENKRNDLDVFAYSSIINGLCNARRVDEAFDMIDRMAKHGC
KPNAHVCNTLLNGLIRASKIEDAIRFFTDMASKNCLPTVVTYNTLINGLCKAERFDVAYL
LVKEMLEKEWKPDIITYSLLMRGLCQGKKIDMALNLWCQVVEKGLKPDVIMHNIIIHGLC
SAGKVEDALQLYLKMSQCDCVPNLVTLNTLMDGFYKARDCLNASVIWARILRSGLKPDII
SYNJVLKGLCSCYRIS
Has anyone else had this problem? I don't understand why 'J' is an unrecognised character.
Hope you can help.
1 answer
J is a placeholder "used in cases where chemical or crystallographic analysis of a peptide or protein cannot conclusively determine the identity of a residue." It does not represent a proteinogenic amino acid (but an amibiguity between I and L) and exonerate does not have a translation table for it. Replace it either with leucine or isoleucine.
I would not remove it, unless you require from exonerate 100% agreement (this is not recommended BTW) or mismatch codon can ruin your analysis.
Sorry, to clarify, I mean to remove the whole sequence (i.e. any sequence containing "J") in my dataset. These sequences are part of a set of over 500,000 protein sequences from asterids species related to my species of interest, to be used as evidence alignments, so it should not affect the analysis too much. This should be OK? (as apposed to removing just the character itself). Thanks again
Log in to answer this question.